P2RX2 Rabbit Polyclonal Antibody

• Catalog Number: orb575423
• Category: Antibodies
• Description: Rabbit polyclonal antibody to P2RX2
• Target: P2RX2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human P2RX2
• Protein Sequence: Synthetic peptide located within the following region: LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK
• UniProt ID: Q9UBL9
• MW: 42kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P2X2, DFNA41
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_777361

Positive control (+): Mouse Spleen (M-SP), Negative control (-): Mouse Kidney (M-KI), Antibody concentration: 1 ug/ml.

Human kidney

WB Suggested Anti-P2RX2 Antibody Titration: 0.6 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.