P2RX1 Rabbit Polyclonal Antibody

• Catalog Number: orb575374
• Category: Antibodies
• Description: Rabbit polyclonal antibody to P2RX1
• Target: P2RX1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human P2RX1
• Protein Sequence: Synthetic peptide located within the following region: VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG
• UniProt ID: P51575
• MW: 45kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P2X1
• Research Area: Cell Biology, Molecular Biology, Pharmacology & Dr
• Note: For research use only
• NCBI: NP_002549

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be lipidated and/or phosphorylated.

Human Pancreas

WB Suggested Anti-P2RX1 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.