You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291655 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant OXSR1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG3 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI |
Tested applications | ELISA, IF, WB |
Clone Number | 1C8 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH08726.1 |
Immunofluorescence of monoclonal antibody to OXSR1 on HeLa cell. [antibody concentration 10 ug/ml]
OXSR1 monoclonal antibody (M06), clone 1C8 Western Blot analysis of OXSR1 expression in HeLa.
Western Blot detection against Immunogen (36.63 KDa).