OXSR1 monoclonal antibody (M06), clone 1C8

• Catalog Number: orb2291655
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant OXSR1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1C8
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG3 Kappa
• Immunogen: OXSR1 (AAH08726.1, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI
• NCBI: AAH08726.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to OXSR1 on HeLa cell. [antibody concentration 10 ug/ml]

OXSR1 monoclonal antibody (M06), clone 1C8 Western Blot analysis of OXSR1 expression in HeLa.

Western Blot detection against Immunogen (36.63 KDa).