Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Oxsr1 Rabbit Polyclonal Antibody

SKU: orb330562

Description

Oxsr1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Oxsr1. It is suitable for WB and is reactive with mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetOxsr1
Protein SequenceSynthetic peptide located within the following region: RAPTISERSKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEGRAAISQ
Molecular Weight58 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti 2210022N24Rik antibody, anti 2810422B09Rik antibody, anti AI462649 antibody, anti AW209236 antibody, anti Osr1 antibody, anti mKIAA1101 antibody

Similar Products

  • Mouse Oxsr1 Antibody (N-term) [orb32267]

    IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • OXSR1 Rabbit Polyclonal Antibody [orb1939858]

    ELISA,  FC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • OXSR1 Rabbit Polyclonal Antibody [orb629587]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • OXSR1 rabbit pAb Antibody [orb771017]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • OXSR1 Rabbit Polyclonal Antibody [orb214947]

    IF,  WB

    Bovine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 30 μl, 100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Oxsr1 Rabbit Polyclonal Antibody

25 ug of the indicated Mouse tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by phosphorylation.

Oxsr1 Rabbit Polyclonal Antibody

WB Suggested Anti-Oxsr1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_598746

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Oxsr1 Rabbit Polyclonal Antibody (orb330562)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry