OTX1 polyclonal antibody (A01)

• Catalog Number: orb2292475
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a partial recombinant OTX1.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: 50 % glycerol
• Immunogen: OTX1 (NP_055377, 10 a.a. ~ 116 a.a) partial recombinant protein with GST tag.
• Protein Sequence: YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVR
• Tested applications: ELISA, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_055377

OTX1 polyclonal antibody (A01), Western Blot analysis of OTX1 expression in Jurkat.

OTX1 polyclonal antibody (A01), Western Blot analysis of OTX1 expression in Raw 264.7.

Western Blot detection against Immunogen (37.88 KDa).