OSBPL8 Rabbit Polyclonal Antibody

SKU: orb325151

Description

OSBPL8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of OSBPL8. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human OSBPL8. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OSBPL8
• Target: OSBPL8
• Protein Sequence: Synthetic peptide located within the following region: SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS
• Molecular Weight: 97kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp686A11164 antibody, anti MGC126578 antibody, anti MGC133203 antibody, anti MST120 antibody, anti MSTP120 antibody, anti ORP8 antibody, anti OSBP10 antibody

Quick Database Links

Gene Symbol

OSBPL8

UniProt

Q68D75

RefSeq (Protein):NP_001003712