Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

OSBPL8 Rabbit Polyclonal Antibody

SKU: orb325151

Description

OSBPL8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of OSBPL8. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human OSBPL8. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human OSBPL8
TargetOSBPL8
Protein SequenceSynthetic peptide located within the following region: SQRQGKEAYPTPTKDLHQPSLSPASPHSQGFERGKEDISQNKDESSLSMS
Molecular Weight97kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti DKFZp686A11164 antibody, anti MGC126578 antibody, anti MGC133203 antibody, anti MST120 antibody, anti MSTP120 antibody, anti ORP8 antibody, anti OSBP10 antibody

Similar Products

  • OSBPL8 Rabbit Polyclonal Antibody [orb1676227]

    ELISA,  FC,  ICC,  IF,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • OSBPL8 Rabbit Polyclonal Antibody [orb325152]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • ORP8 Rabbit Polyclonal Antibody (FITC) [orb103152]

    IF

    Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rat, Sheep

    Rabbit

    Polyclonal

    FITC

    100 μl
  • ORP8 Rabbit Polyclonal Antibody (HRP) [orb480898]

    ELISA,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rat, Sheep

    Rabbit

    Polyclonal

    HRP

    100 μl
  • ORP8 Rabbit Polyclonal Antibody [orb100779]

    ELISA,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Human, Mouse, Porcine, Rat, Sheep

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

OSBPL8 Rabbit Polyclonal Antibody

Rabbit Anti-OSBPL8 Antibody, Catalog Number: orb325151, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm and plasma membrane in Kupffer cells and sinusoids, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

OSBPL8 Rabbit Polyclonal Antibody

WB Suggested Anti-OSBPL8 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate, OSBPL8 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

OSBPL8 Rabbit Polyclonal Antibody (orb325151)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry