ORMDL3 Rabbit Polyclonal Antibody

• Catalog Number: orb585948
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ORMDL3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17kDa
• Target: ORMDL3
• UniProt ID: Q8N138
• Protein Sequence: Synthetic peptide located within the following region: GTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTN
• NCBI: NP_644809
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): HepG2 cell lysate (HG), Negative control (-): THP1 cell lysate (N30), Antibody concentration: 4 ug/ml.

WB Suggested Anti-ORMDL3 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.