OR5T2 Rabbit Polyclonal Antibody

• Catalog Number: orb578244
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OR5T2
• Target: OR5T2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human OR5T2
• Protein Sequence: Synthetic peptide located within the following region: DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK
• UniProt ID: Q6IFC8
• MW: 39kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: OR11-177
• Note: For research use only
• NCBI: NP_001004746

WB Suggested Anti-OR5T2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.