You have no items in your shopping cart.
Cart summary
Item 1 of 1
OR1C1 Rabbit Polyclonal Antibody
Catalog Number: orb326301
| Catalog Number | orb326301 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Olfr364-ps1 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
| Reactivity | Mouse |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of mouse OR1C1 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 33kDa |
| Target | OR1C1 |
| UniProt ID | Q15619 |
| Protein Sequence | Synthetic peptide located within the following region: SVIYVYFRPLSMYSVVKDRIATVMYTVVTPMMNPFIYSLRNKDMKRGLRK |
| NCBI | NP_036485.2 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | OR1-42, ORL211, TPCR27, HSTPCR27, OR1.5.10 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: Mouse Lung lysates, Antibody Dilution: 1.0 ug/mL.
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
