OCLN monoclonal antibody (M01), clone 1G7

• Catalog Number: orb2292484
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant OCLN.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1G7
• Tested applications: ELISA, IF, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: OCLN (NP_002529, 423 a.a. ~ 522 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
• NCBI: NP_002529
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged OCLN is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to OCLN on HeLa cell. [antibody concentration 10 ug/ml]

Immunoprecipitation of OCLN transfected lysate using anti-OCLN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with OCLN MaxPab rabbit polyclonal antibody.

OCLN monoclonal antibody (M01), clone 1G7 Western Blot analysis of OCLN expression in HL-60.

Western Blot detection against Immunogen (36.74 KDa).