OBP2B Rabbit Polyclonal Antibody

• Catalog Number: orb327039
• Category: Antibodies
• Description: Rabbit polyclonal antibody to OBP2B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human OBP2B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 18kDa
• Target: OBP2B
• UniProt ID: Q9NPH6
• Protein Sequence: Synthetic peptide located within the following region: RKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREALEEFKK
• NCBI: NP_055396
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti OBP2B antibody, anti UNQ653/PRO1283 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: 786-0 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.