OBP28 Protein, Culex quinquefasciatus, Recombinant (His)

• Catalog Number: orb1979457
• Category: Proteins
• Description: OBP28 Protein, Culex quinquefasciatus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.1 kDa and the accession number is B0XC79.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 16.1 kDa (predicted)
• UniProt ID: B0XC79
• Protein Sequence: DEASDKEQAKEQAKQMLRSMTQKCKEAEGASDDDVEAMIDDVMPESQVQKCFHSCVQQQFGVSDGQKFLQQGFLEIMMMAVGNDEQQQGHAKEVAEECDGVANEDRCQLAVDIMTCVKQGMEKRGMKVDR
• Expression System: P. pastoris (Yeast)
• Biological Origin: Culex quinquefasciatus
• Biological Activity: N/A. OBP28 Protein, Culex quinquefasciatus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.1 kDa and the accession number is B0XC79.
• Expression Region: 21-150 aa
• Storage: -20°C
• Note: For research use only
• Application notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
• Expiration Date: 6 months from date of receipt.