You have no items in your shopping cart.
Cart summary
OBP28 Protein, Culex quinquefasciatus, Recombinant (His & Myc)
Catalog Number: orb1979458
| Catalog Number | orb1979458 |
|---|---|
| Category | Proteins |
| Description | OBP28 Protein, Culex quinquefasciatus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 22 kDa and the accession number is B0XC79. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 22 kDa (predicted) |
| UniProt ID | B0XC79 |
| Protein Sequence | DEASDKEQAKEQAKQMLRSMTQKCKEAEGASDDDVEAMIDDVMPESQVQKCFHSCVQQQFGVSDGQKFLQQGFLEIMMMAVGNDEQQQGHAKEVAEECDGVANEDRCQLAVDIMTCVKQGMEKRGMKVDR |
| Expression System | E. coli |
| Biological Origin | Culex quinquefasciatus |
| Biological Activity | N/A. OBP28 Protein, Culex quinquefasciatus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 22 kDa and the accession number is B0XC79. |
| Expression Region | 21-150 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
