You have no items in your shopping cart.
Cart summary
Item 1 of 1
NVL Rabbit Polyclonal Antibody
Catalog Number: orb585068
Product Properties
| Catalog Number | orb585068 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NVL |
| Target | NVL |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Porcine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: LSCEKSNPKKPITEIQDSKDSSLLESDMKRKGKLKNKGSKRKKEDLQEVD |
| UniProt ID | O15381 |
| MW | 83kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | NVL2 |
| Research Area | Epigenetics & Chromatin, Immunology & Inflammation Read more... |
| Note | For research use only |
| NCBI | NP_996671 |
Images
WB Suggested Anti-NVL Antibody, Titration: 1.0 ug/ml, Positive Control: THP-1 Whole Cell.
Similar Products
- Item 1 of 1
- Item 1 of 2
NVL Rabbit Polyclonal Antibody [orb312376]
IF, IHC-Fr, IHC-P
Canine, Equine, Gallus, Human
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Reviews
NVL Rabbit Polyclonal Antibody (orb585068)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review