NUDCD3 Rabbit Polyclonal Antibody

• Catalog Number: orb588022
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NUDCD3
• Target: NUDCD3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen for Anti-NUDCD3 antibody is: synthetic peptide directed towards the middle region of Human NUDC3
• Protein Sequence: Synthetic peptide located within the following region: AHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKNPDSYNGAVRENYTW
• UniProt ID: Q8IVD9
• MW: 39 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NudCL
• Research Area: Stem Cell & Developmental Biology
• Note: For research use only
• NCBI: NP_056147.2

WB Suggested Anti-NUDC3 antibody Titration: 1 ug/ml, Sample Type: Human Fetal Liver.