NUCB1 Rabbit Polyclonal Antibody

• Catalog Number: orb592974
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NUCB1
• Target: NUCB1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Canine, Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
• Protein Sequence: Synthetic peptide located within the following region: SQPDGQLQFRADTGDAPVPAPAGDQKDVPASEKKVPEQPPVLPQLDSQHL
• UniProt ID: Q63083
• MW: 54kDa
• Tested applications: IHC
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Nucb
• Note: For research use only
• NCBI: NP_445915

Rat NRK

WB Suggested Anti-NUCB1 Antibody Titration: 5.0 ug/ml, Positive Control: Hela cell lysate.