NTN4 Rabbit Polyclonal Antibody

• Catalog Number: orb325495
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NTN4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NTN4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 70kDa
• Target: NTN4
• UniProt ID: Q9HB63
• Protein Sequence: Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY
• NCBI: NP_067052
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ23180 antibody, anti PRO3091 antibody
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

rat and mouse brain

WB Suggested Anti-NTN4 Antibody Titration: 0.2-1 ug/mL, Positive Control: MCF7 cell lysate.