NSUN6 Rabbit Polyclonal Antibody

SKU: orb330159

Description

Rabbit polyclonal antibody to NSUN6

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NSUN6
• Target: NSUN6
• Protein Sequence: Synthetic peptide located within the following region: MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPP
• Molecular Weight: 52kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 4933414E04Rik antibody, anti FLJ23743 antibody, anti NOPD1 antibody

WB Suggested Anti-NSUN6 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human muscle.

Quick Database Links

Gene Symbol

NSUN6

UniProt

Q8TEA1

RefSeq (Protein):NP_872349