NSUN5C Rabbit Polyclonal Antibody

SKU: orb580598

Description

Rabbit polyclonal antibody to NSUN5C

Research Area

Cardiovascular Disease

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NSUN5C
• Target: NSUN5P2
• Protein Sequence: Synthetic peptide located within the following region: PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA
• Molecular Weight: 34kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

NOL1R2, NSUN5C, WBSCR20B, WBSCR20C

WB Suggested Anti-NSUN5C Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate. NSUN5P2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.

Quick Database Links

Gene Symbol

NSUN5P2

UniProt

Q63ZY6

RefSeq (Protein):NP_115534