NSUN5C Rabbit Polyclonal Antibody

SKU: orb580598

Description

NSUN5C Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of NSUN5P2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human NSUN5C. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cardiovascular Disease

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NSUN5C
• Target: NSUN5P2
• Protein Sequence: Synthetic peptide located within the following region: PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA
• Molecular Weight: 34kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

NOL1R2, NSUN5C, WBSCR20B, WBSCR20C

Quick Database Links

Gene Symbol

NSUN5P2

UniProt

Q63ZY6

RefSeq (Protein):NP_115534