NSMCE1 Rabbit Polyclonal Antibody

• Catalog Number: orb578819
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NSMCE1
• Target: NSMCE1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NSMCE1
• Protein Sequence: Synthetic peptide located within the following region: RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL
• UniProt ID: Q8WV22
• MW: 28kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NSE1
• Research Area: Immunology & Inflammation, Molecular Biology
• Note: For research use only
• NCBI: NP_659547

WB Suggested Anti-NSMCE1 Antibody Titration: 2.5 ug/ml, Positive Control: HepG2 cell lysate.