NR5A1 Rabbit Polyclonal Antibody

• Catalog Number: orb579514
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NR5A1
• Target: NR5A1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: LQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA
• UniProt ID: Q13285
• MW: 52kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ELP, SF1, FTZ1, POF7, SF-1, AD4BP, FTZF1, SPGF8, S
• Note: For research use only
• NCBI: NP_004950

Rabbit Anti-NR5A1 Antibody, Catalog Number: orb579514, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear and some weak cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-NR5A1 antibody Titration: 1 ug/ml, Sample Type: Human heart.

WB Suggested Anti-NR5A1 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell. NR5A1 is supported by BioGPS gene expression data to be expressed in HepG2.