You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F6 |
| Target | NR2F6 |
| Protein Sequence | Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP |
| Molecular Weight | 43kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−EAR2 rabbit pAb Antibody [orb765093]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlNR2F6 Rabbit Polyclonal Antibody [orb213902]
IF, IHC, WB
Bovine, Canine, Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 30 μl, 100 μl, 200 μlNR2F6 Rabbit Polyclonal Antibody [orb579519]
IHC, WB
Bovine, Canine, Guinea pig, Mouse, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

NR2F6 antibody - N-terminal region (orb574104), Catalog Number: orb574104, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Nucleus in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

NR2F6 antibody - N-terminal region (orb574104), Catalog Number: orb574104, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Nucleus of pneumocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-NR2F6 Antibody, Titration: 0.2 ug/ml, Positive Control: Jurkat Whole Cell.
Documents Download
Request a Document
Protocol Information
NR2F6 Rabbit Polyclonal Antibody (orb574104)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review












