NPY4R Rabbit Polyclonal Antibody

• Catalog Number: orb586570
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NPY4R
• Target: NPY4R
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPY4R
• Protein Sequence: Synthetic peptide located within the following region: SIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLT
• UniProt ID: P50391
• MW: 41kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Y4, PP1, PPYR1, NPY4-R
• Research Area: Signal Transduction
• Note: For research use only
• NCBI: XP_005277701
• Expiration Date: 12 months from date of receipt.

Sample Type: NCI-H226 Whole cell lysates, Antibody dilution: 1.0 ug/ml.