NPY Rabbit Polyclonal Antibody

• Catalog Number: orb333712
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Neuropeptide Y
• Target: NPY
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NPY
• Protein Sequence: Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP
• UniProt ID: P01303
• MW: 11 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti C-flanking peptide of NPY antibody, anti CPON
• Research Area: Neuroscience
• Note: For research use only
• NCBI: NP_000896
• Expiration Date: 12 months from date of receipt.

25 ug of PANC1 whole cell extract was loaded onto a 10-20% SDS-PAGE gel. Blot was incubated with 3 ug/ml of antibody.

Sample Type: Esophagus Tumor lysates, Antibody dilution: 1.0 ug/ml.