You have no items in your shopping cart.
Cart summary
Item 1 of 1
NPB Rabbit Polyclonal Antibody
Catalog Number: orb326468
| Catalog Number | orb326468 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NPB |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of NPB |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 14kDa |
| Target | NPB |
| UniProt ID | Q8NG41 |
| Protein Sequence | Synthetic peptide located within the following region: PPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANV |
| NCBI | NP_683694 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti PPL7 antibody, anti PPNPB antibody, anti L7 a Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-NPB Antibody, Titration: 1.0 ug/mL, Positive Control: Fetal Brain.
- Item 1 of 2
- Item 1 of 1
GPR7 Rabbit Polyclonal Antibody [orb157362]
WB
Human
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
- Item 1 of 1
NPB Rabbit Polyclonal Antibody (HRP) [orb2093765]
WB
Bovine, Canine, Human, Rat
Rabbit
Polyclonal
HRP
100 μl
