NOX4 Rabbit Polyclonal Antibody

• Catalog Number: orb578136
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NOX4
• Target: NOX4
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOX4
• Protein Sequence: Synthetic peptide located within the following region: VCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSGDDWK
• UniProt ID: Q9NPH5
• MW: 37kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: KOX, KOX-1, RENOX
• Note: For research use only
• NCBI: NP_001137308.1

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.