Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

NOTCH2 Rabbit Polyclonal Antibody

SKU: orb329683

Description

Rabbit polyclonal antibody to NOTCH2

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NOTCH2
TargetNOTCH2
Protein SequenceSynthetic peptide located within the following region: FPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQW
Molecular Weight85kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti-hN2 antibody, anti-Motch B antibody, anti-N2ECD antibody, anti-N2ICD antibody, anti-neurogenic locus notch homolog protein 2 antibody, anti-Notch 2 antibody, anti-Notch 2 intracellular domain antibody, anti-Notch Drosophila homolog 2 antibody, anti-Notch homolog 2 antibody, anti-Notch homolog 2 Drosophila antibody, anti-Notch2 antibody, anti-Notch 2 antibody, anti-Notch-2 antibody

Similar Products

  • NOTCH2 Rabbit Polyclonal Antibody [orb570344]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Cleaved-Notch 2 (D1733) Polyclonal Antibody [orb1416116]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Cleaved-Notch 2 (A1734) rabbit pAb Antibody [orb769282]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Cleaved-Notch 2 (V1697) rabbit pAb Antibody [orb769283]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • NOTCH2 Rabbit Polyclonal Antibody [orb1292533]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NOTCH2 Rabbit Polyclonal Antibody

WB Suggested Anti-NOTCH2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate, There is BioGPS gene expression data showing that NOTCH2 is expressed in 721_B.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_077719

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

NOTCH2 Rabbit Polyclonal Antibody (orb329683)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry