Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Nme1 Rabbit Polyclonal Antibody

SKU: orb576557

Description

Nme1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Nme1. It is suitable for DOT, WB and is reactive with human, mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Yeast. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsDOT, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetNme1
Protein SequenceSynthetic peptide located within the following region: NVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEIS
Molecular Weight17kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

NDP, NM23A, NDPK-A, NM23-M, NM23-M1, AL024257

Similar Products

  • NME1/NM23A Rabbit Polyclonal Antibody [orb1816927]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • NME1 Rabbit Polyclonal Antibody [orb592639]

    DOT,  IHC,  WB

    Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • NM23A/NME1 Rabbit Polyclonal Antibody [orb76342]

    FC,  ICC,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • NM23-H1 rabbit pAb Antibody [orb765844]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • NM23A Rabbit pAb Antibody [orb763834]

    IHC

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Nme1 Rabbit Polyclonal Antibody

DB Suggested Anti-Nme1 antibody, Titration: 0.5 ug/ml, Positive Control: Recomninant human NME2 protein.

Nme1 Rabbit Polyclonal Antibody

Lanes: 1. 20 ug human MDA-MB-231 cell lysate, 2. 20 ug murine 4T1 primary breast tumor cell lysate, 3. 20 ug human MDA-MB-231 cell lysate, 4. 20 ug murine 4T1 primary breast tumor cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody Dilution: 1:25000, Gene Name: Nme1.

Nme1 Rabbit Polyclonal Antibody

WB Suggested Anti-Nme1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_032730

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
DOT
Dot Blot
View Protocol

Nme1 Rabbit Polyclonal Antibody (orb576557)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry