Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Nme1 Rabbit Polyclonal Antibody

SKU: orb576557

Description

Rabbit polyclonal antibody to Nme1

Research Area

Neuroscience, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsDOT, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetNme1
Protein SequenceSynthetic peptide located within the following region: NVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEIS
Molecular Weight17kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

NDP, NM23A, NDPK-A, NM23-M, NM23-M1, AL024257

Similar Products

  • NME1/NM23A Rabbit Polyclonal Antibody [orb1816927]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • NME1 Rabbit Polyclonal Antibody [orb592639]

    DOT,  IHC,  WB

    Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • NM23-H1 rabbit pAb Antibody [orb765844]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • NM23A/NME1 Rabbit Polyclonal Antibody [orb76342]

    FC,  ICC,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • NM23A Rabbit pAb Antibody [orb763834]

    IHC

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Nme1 Rabbit Polyclonal Antibody

DB Suggested Anti-Nme1 antibody, Titration: 0.5 ug/ml, Positive Control: Recomninant human NME2 protein.

Nme1 Rabbit Polyclonal Antibody

Lanes: 1. 20 ug human MDA-MB-231 cell lysate, 2. 20 ug murine 4T1 primary breast tumor cell lysate, 3. 20 ug human MDA-MB-231 cell lysate, 4. 20 ug murine 4T1 primary breast tumor cell lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody Dilution: 1:25000, Gene Name: Nme1.

Nme1 Rabbit Polyclonal Antibody

WB Suggested Anti-Nme1 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_032730

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
DOT
Dot Blot
View Protocol

Nme1 Rabbit Polyclonal Antibody (orb576557)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry