NLRX1 Rabbit Polyclonal Antibody

SKU: orb586183

Description

Rabbit polyclonal antibody to NLRX1

Research Area

Immunology, Infectious Diseases

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NLRX1
• Target: NLRX1
• Protein Sequence: Synthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ
• Molecular Weight: 101kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

NOD5, NOD9, NOD26, DLNB26, CLR11.3

Sample Type: Lane 1: 35 ug mouse neuroblastoma cells w/ empty vector, Lane 2: 35 ug mouse neuroblastoma cells w/ NLRX1 siRNA, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: NLRX1.

Quick Database Links

Gene Symbol

NLRX1

UniProt

Q86UT6

RefSeq (Protein):NP_733840