You have no items in your shopping cart.
Cart summary
Item 1 of 1
NHLH2 Rabbit Polyclonal Antibody
Catalog Number: orb588418
| Catalog Number | orb588418 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to NHLH2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen for Anti-NHLH2 antibody is: synthetic peptide directed towards the N-terminal of Human HEN2 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 14 kDa |
| Target | NHLH2 |
| UniProt ID | Q02577 |
| Protein Sequence | Synthetic peptide located within the following region: DLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRE |
| NCBI | XP_006710729.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | HEN2, NSCL2, bHLHa34 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: ACHN Whole Cell, Antibody Dilution: 1.0 ug/ml.
- Item 1 of 3
Anti-HEN1/2 Antibody [orb256591]
IF, IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl - Item 1 of 3
- Item 1 of 3
- Item 1 of 1
- Item 1 of 1
