NGFR Rabbit Polyclonal Antibody

SKU: orb331221

Description

Rabbit polyclonal antibody to NGFR

Research Area

Neuroscience, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: NGFR
• Protein Sequence: Synthetic peptide located within the following region: VTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQ
• Molecular Weight: 47kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CD271 antibody, anti Gp80-LNGFR antibody, anti TNFRSF16 antibody, anti p75(NTR) antibody, anti p75NTR antibody

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

WB Suggested Anti-NGFR Antibody, Titration: 1.0 ug/ml, Positive Control: ACHN Whole Cell.

Quick Database Links

Gene Symbol

NGFR

UniProt

P08138

RefSeq (Protein):NP_002498