NGFR Rabbit Polyclonal Antibody

• Catalog Number: orb331221
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NGFR
• Target: NGFR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: VTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQ
• UniProt ID: P08138
• MW: 47kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CD271 antibody, anti Gp80-LNGFR antibody, ant
• Note: For research use only
• NCBI: NP_002498

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

WB Suggested Anti-NGFR Antibody, Titration: 1.0 ug/ml, Positive Control: ACHN Whole Cell.