NFIC Rabbit Polyclonal Antibody

SKU: orb592965

Description

Rabbit polyclonal antibody to NFIC

Research Area

Cell Biology, Epigenetics & Chromatin, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NFIC
• Target: NFIC
• Protein Sequence: Synthetic peptide located within the following region: KSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSIL
• Molecular Weight: 55kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CTF, NFI, CTF5, NF-I

Sample Tissue: Mouse Kidney, Antibody Dilution: 1 ug/ml.

Human Adipocytes

Immunohistochemistry with Human Adipocytes tissue.

WB Suggested Anti-NFIC Antibody Titration: 1 ug/ml, Positive Control: MCF-7 whole cell lysates.

Quick Database Links

Gene Symbol

NFIC

UniProt

Q6FI30

RefSeq (Protein):NP_995315