You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1976861 |
---|---|
Category | Proteins |
Description | Mediates the viral entry into the host cell together with fusion/F protein. Attaches the virus to sialic acid-containing cell receptors and thereby initiates infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion.; Neuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins. Newcastle disease virus (NDV) (strain Her/33) Hemagglutinin-neuraminidase Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 45.1 kDa and the accession number is P35741. |
Tag | N-6xHis |
Purity | 98.00% |
MW | 45.1 kDa (predicted) |
UniProt ID | P35741 |
Protein Sequence | NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP |
Expression System | E. coli |
Biological Origin | NDV |
Biological Activity | Mediates the viral entry into the host cell together with fusion/F protein. Attaches the virus to sialic acid-containing cell receptors and thereby initiates infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion.; Neuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins. Newcastle disease virus (NDV) (strain Her/33) Hemagglutinin-neuraminidase Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 45.1 kDa and the accession number is P35741. |
Expression Region | 115-473 aa |
Storage | -20°C |
Note | For research use only |
Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Expiration Date | 6 months from date of receipt. |