You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb234342 |
---|---|
Category | Antibodies |
Description | Neuropeptide Y/NPY Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Gallus |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Neuropeptide Y (29-64aa YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human, By Heat Western blot, 0.1-0.5μg/ml, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 10851 MW |
UniProt ID | P01303 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Pro-neuropeptide Y;Neuropeptide Y;Neuropeptide tyr Read more... |
Note | For research use only |
Application notes | WB: The detection limit for Neuropeptide Y is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of Recombinant Human Neuropeptide Y Protein 0.5ng using Anti Neuropeptide Y antibody.
IHC(P) analysis of Mouse Brain Tissue using Anti-Neuropeptide Y Picoband antibody.
IHC(P) analysis of Rat Brain Tissue using Anti-Neuropeptide Y Picoband antibody.
Filter by Rating