NEUROD6 Rabbit Polyclonal Antibody

• Catalog Number: orb574192
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NEUROD6
• Target: NEUROD6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NEUROD6
• Protein Sequence: Synthetic peptide located within the following region: MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDRE
• UniProt ID: Q96NK8
• MW: 39kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Nex1, Atoh2, MATH2, NEX1M, Math-2, bHLHa2
• Note: For research use only
• NCBI: NP_073565

WB Suggested Anti-NEUROD6 Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.