NEIL1 Rabbit Polyclonal Antibody

SKU: orb585785

Description

Rabbit polyclonal antibody to NEIL1

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Porcine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: NEIL1
• Protein Sequence: Synthetic peptide located within the following region: SLQDRHGRTIWFQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSK
• Molecular Weight: 44kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FPG1, NEI1, hFPG1

WB Suggested Anti-NEIL1 Antibody, Titration: 1.0 ug/ml, Positive Control: PANC1 Whole Cell. NEIL1 is supported by BioGPS gene expression data to be expressed in PANC1.

Quick Database Links

Gene Symbol

NEIL1

UniProt

Q96FI4

RefSeq (Protein):NP_078884