NEDD4 Rabbit Polyclonal Antibody

SKU: orb578703

Description

NEDD4 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of NEDD4. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human NEDD4. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NEDD4
• Target: NEDD4
• Protein Sequence: Synthetic peptide located within the following region: SRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRT
• Molecular Weight: 104kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RPF1, NEDD4-1

Quick Database Links

Gene Symbol

NEDD4

UniProt

B4E2R7

RefSeq (Protein):NP_006145