NDUFV3 Rabbit Polyclonal Antibody

• Catalog Number: orb579569
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NDUFV3
• Target: NDUFV3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFV3
• Protein Sequence: Synthetic peptide located within the following region: PAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPSSGRESPR
• UniProt ID: P56181
• MW: 47kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CI-10k, CI-9KD
• Note: For research use only
• NCBI: NP_066553
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-NDUFV3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HT1080 cell lysate.

WB Suggested Anti-NDUFV3 Antibody Titration: 5% Milk, ELISA Titer: dilution: 1:500, Positive Control: Human LCL.