NDUFB11 Rabbit Polyclonal Antibody

• Catalog Number: orb580731
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NDUFB11
• Target: NDUFB11
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUFB11
• Protein Sequence: Synthetic peptide located within the following region: PSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRL
• UniProt ID: Q9NX14
• MW: 16kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ESSS, Np15, P17.3, NP17.3, CI-ESSS, MC1DN30
• Research Area: Cardiovascular Disease
• Note: For research use only

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Hela Whole Cell lysates, Antibody dilution: 1.0 ug/ml.