NDUFA13 Rabbit Polyclonal Antibody

• Catalog Number: orb327376
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NDUAD
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUAD
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 15kDa
• Target: NDUFA13
• UniProt ID: Q9P0J0
• Protein Sequence: Synthetic peptide located within the following region: MPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRR
• NCBI: NP_057049
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti NDUFA13 antibody, anti GRIM19 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human A549, Antibody Dilution: 1.0 ug/mL.

Sample Type: Fetal Kidney lysates, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.