NDNF Rabbit Polyclonal Antibody

• Catalog Number: orb587129
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NDNF
• Target: NDNF
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NDNF
• Protein Sequence: Synthetic peptide located within the following region: NEDQKKREQNQCLGPDIRKKSEKVLCKYFHSQNLQKAVTTETIKGLQPGK
• UniProt ID: Q8TB73
• MW: 65 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HH25, NORD, C4orf31
• Research Area: Cell Biology, Neuroscience
• Note: For research use only
• NCBI: NP_078850

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Type: MCF7 Whole cell lysates, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): Human fetal heart (HE), Antibody concentration: 1 ug/ml.