Aadacl1 Rabbit Polyclonal Antibody

• Catalog Number: orb325487
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Nceh1
• Target: Nceh1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS
• UniProt ID: Q8BLF1
• MW: 46kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti Aadacl1 antibody, anti B230106I24Rik antibody
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_848887
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation.

Sample Tissue: Human SP2/0 Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-Aadacl1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Mouse Kidney.