NCAPD2 Rabbit Polyclonal Antibody

• Catalog Number: orb330476
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NCAPD2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Porcine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NCAPD2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 157kDa
• Target: NCAPD2
• UniProt ID: Q15021
• Protein Sequence: Synthetic peptide located within the following region: KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL
• NCBI: NP_055680
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CAP-D2 antibody, anti CNAP1 antibody, anti KI
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, NCAPD2 is supported by BioGPS gene expression data to be expressed in HeLa.

WB Suggested Anti-NCAPD2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.