NBEAL1 Rabbit Polyclonal Antibody

• Catalog Number: orb577954
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NBEAL1
• Target: NBEAL1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Guinea pig
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NBEAL1
• Protein Sequence: Synthetic peptide located within the following region: KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT
• UniProt ID: Q6ZS30
• MW: 153kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ALS2CR16, ALS2CR17, A530083I02Rik
• Research Area: Molecular Biology
• Note: For research use only
• NCBI: NP_945183

Concentration: 1 ug/ml, Sample: 25 ug Mouse Lung.

WB Suggested Anti-NBEAL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: MCF7 cell lysate.