NAXD Rabbit Polyclonal Antibody

SKU: orb580046

Description

Rabbit polyclonal antibody to NAXD

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CARKD
• Target: NAXD
• Protein Sequence: Synthetic peptide located within the following region: RLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPA
• Molecular Weight: 37 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CARKD, LP3298, PEBEL2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Immunogen sequence is present in 41 kDa, 37 kDa, 35 kDa and 25 kDa isoforms. Protein is glycosylated.

Sample Type: Jurkat, Antibody dilution: 1.0 ug/ml. CARKD is supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-CARKD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

NAXD

UniProt

Q8IW45

RefSeq (Protein):NP_060680