NAT2 monoclonal antibody (M01), clone 3B5

• Catalog Number: orb2296536
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant NAT2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: NAT2 (AAH15878, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: PPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLE
• Tested applications: ELISA, WB
• Clone Number: 3B5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH15878

Western Blot analysis of NAT2 expression in transfected 293T cell line by NAT2 monoclonal antibody (M01), clone 3B5. Lane 1: NAT2 transfected lysate(33.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.63 KDa).