You have no items in your shopping cart.
Cart summary
Napsin-A/NAPSA Protein, Human, Recombinant (His)
Catalog Number: orb1978166
| Catalog Number | orb1978166 |
|---|---|
| Category | Proteins |
| Description | May be involved in processing of pneumocyte surfactant precursors. Napsin-A/NAPSA Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 42.5 kDa and the accession number is O96009. |
| Tag | N-6xHis |
| Purity | 98.00% |
| Protein Sequence | KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG |
| UniProt ID | O96009 |
| MW | 42.5 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | May be involved in processing of pneumocyte surfactant precursors. Napsin-A/NAPSA Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 42.5 kDa and the accession number is O96009. |
| Expression Region | 64-420 aa |
| Storage | -20°C |
| Note | For research use only |
