You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1978166 |
---|---|
Category | Proteins |
Description | May be involved in processing of pneumocyte surfactant precursors. Napsin-A/NAPSA Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 42.5 kDa and the accession number is O96009. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG |
UniProt ID | O96009 |
MW | 42.5 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | E. coli |
Biological Origin | Human |
Biological Activity | May be involved in processing of pneumocyte surfactant precursors. Napsin-A/NAPSA Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 42.5 kDa and the accession number is O96009. |
Expression Region | 64-420 aa |
Storage | -20°C |
Note | For research use only |