NAP1L2 Rabbit Polyclonal Antibody

SKU: orb583620

Description

Rabbit polyclonal antibody to NAP1L2

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NAP1L2
• Target: NAP1L2
• Protein Sequence: Synthetic peptide located within the following region: VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE
• Molecular Weight: 52kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

BPX

WB Suggested Anti-NAP1L2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

NAP1L2

UniProt

P51860

RefSeq (Protein):NP_068798