Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

PBEF1 Rabbit Polyclonal Antibody

SKU: orb324988

Description

PBEF1 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of NAMPT. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human PBEF1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cardiovascular Research, Cell Biology, Disease Biomarkers, Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PBEF1
TargetNAMPT
Protein SequenceSynthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL
Molecular Weight54kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti-NAmPRTase antibody, anti-Nampt antibody, anti-NAMPT_HUMAN antibody, anti-Nicotinamide phosphoribosyltransferase antibody, anti-PBEF 1 antibody, anti-PBEF antibody, anti-PBEF1 antibody, anti-Pre B cell colony enhancing factor 1 antibody, anti-Pre B cell colony enhancing factor antibody, anti-Pre B cell enhancing factor antibody, anti-Pre-B cell-enhancing factor antibody, anti-Pre-B-cell colony-enhancing factor 1 antibody, anti-VF antibody, anti-Visfatin antibody, anti-Visfatin 1 antibody

Similar Products

  • Visfatin Rabbit Polyclonal Antibody [orb11562]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Equine, Gallus, Monkey, Mouse, Porcine

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Visfatin/NAMPT Rabbit Polyclonal Antibody [orb371743]

    ELISA,  FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • NAMPT Antibody (Center) [orb1928156]

    IHC-P,  WB

    Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Visfatin Rabbit Polyclonal Antibody [orb11564]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Monkey, Mouse

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • NAMPT Rabbit Polyclonal Antibody [orb632522]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005737

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry