NAGS Rabbit Polyclonal Antibody

• Catalog Number: orb581294
• Category: Antibodies
• Description: Rabbit polyclonal antibody to NAGS
• Target: NAGS
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NAGS
• Protein Sequence: Synthetic peptide located within the following region: YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD
• UniProt ID: Q8N159
• MW: 58 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: AGAS, ARGA
• Research Area: Signal Transduction
• Note: For research use only
• NCBI: NP_694551

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by acetylation.

Positive control (+): HepG2 Cell Lysate (HG), Negative control (-): Human Ovary Tumor (T-OV), Antibody concentration: 1 ug/ml.

WB Suggested Anti-NAGS Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.